Bacterial taxon 243277
Locus VC_1526
Protein NP_231166.1
molybdopterin-guanine dinucleotide biosynthesis protein MobA
Vibrio cholerae O1 biovar El Tor str. N16961
Length 203 aa, Gene mobA, UniProt Q9KRV8
>NP_231166.1|Vibrio cholerae O1 biovar El Tor str. N16961|molybdopterin-guanine dinucleotide biosynthesis protein MobA
MITTQTLPTLQPSDTSWVILAGGQASRMGGQDKGLIQLNGQPLVQHVIDKLAPQTPTLLINANRNQSQYQQFAPVISDEFPDYPGPLGGIHAGLSHAPTDWVGFVPCDSPLICDDLVARFCQAVKPESDILVAHDGEHQQPVFTLFHKRVLPKLSAFLARGDRKIILLYDECHTSYVDFSDAPSCFFNLNTPQELAQFGALHP
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | 1 | 5.3e-6 | ○○○○○ 0.87 | 0.8651582177257695 | 24331463 |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)