Bacterial taxon 243277
Locus VC_A0153
Protein NP_232553.1
monovalent cation/H+ antiporter subunit F
Vibrio cholerae O1 biovar El Tor str. N16961
Length 103 aa, Gene n/a, UniProt Q9KN13
>NP_232553.1|Vibrio cholerae O1 biovar El Tor str. N16961|monovalent cation/H+ antiporter subunit F
MVLKNGYWRSLVDNSLPLAIHFAYLGLLLSLAMAFIRLVLGPSLADRVVALDLISFITIGFIVVYSLDSGQQTLLDIALTLGLVAFLGTIAFARFIAKRKGEL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | 1.7 | 0.0051 | ○○○○○ 1.45 | 1.4541410073342385 | 24331463 |
Retrieved 1 of 1 entries in 0.6 ms
(Link to these results)