Bacterial taxon 243277
Locus VC_A0881
Protein NP_233267.1
motility-associated killing factor operon protein MakC
Vibrio cholerae O1 biovar El Tor str. N16961
Length 131 aa, Gene n/a, UniProt Q9KL66
>NP_233267.1|Vibrio cholerae O1 biovar El Tor str. N16961|motility-associated killing factor operon protein MakC
MKKVEILMVVDAAAALASRDLQSNIYLIDTNKYMGSGNEGQAELKTACKDGQLLCWRVVAISPDNEVDIVEFNGQMINDRVCIPTKQGLSGDEFWEGRVEAQGQASTQQYNATLSIDGSRLTFDPFLVISL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -1.05 | 0.014 | ●○○○○ -0.31 | -0.31293663425195034 | 24331463 |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)