Bacterial taxon 243277
Locus VC_A0880
Protein NP_233266.1
motility-associated killing factor operon protein MakD
Vibrio cholerae O1 biovar El Tor str. N16961
Length 126 aa, Gene n/a, UniProt Q9KL67
>NP_233266.1|Vibrio cholerae O1 biovar El Tor str. N16961|motility-associated killing factor operon protein MakD
MKKIEILIVVDCAGALATTSLISNVYLIDSNQWLGSWDEGTCQLHTVSEDGQFICWRSCAISPDDEVNITGFYGDMIDQKACLPSPVNDAWEGRVQTRGDTGRYLYTISLSINGITMNFSPYLEVQ
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | 0.74 | 0.041 | ○○○○○ 0.84 | 0.8380385471366703 | 24331463 |
Retrieved 1 of 1 entries in 1.5 ms
(Link to these results)