Bacterial taxon 243277
Locus VC_0411
Protein NP_230065.1
MSHA pilin protein MshD
Vibrio cholerae O1 biovar El Tor str. N16961
Length 203 aa, Gene n/a, UniProt Q9KUV2
>NP_230065.1|Vibrio cholerae O1 biovar El Tor str. N16961|MSHA pilin protein MshD
MRFAKSASIPKGISMPVKPMIAKRGFTLVEMIIVIVVLGVALVGVTTSLYPRSKQSAEQVLSVKAAELGRAVLDEVLGRAFDQHSGPNGGLPECVITETAGRTLCSAPSALGKDTGESNNTEFNDVDDYITSSPIPVTDVLGTDISSEYQRFSVSIQVFYVSDNGGQFSATPATERTHYKRIALVIYDPQGNAYPFAAIKGNY
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | 0.95 | 0.043 | ○○○○○ 0.84 | 0.8415432332868167 | 24331463 |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)