Bacterial taxon 243277
Locus VC_2293
Protein NP_231924.1
Na(+)-translocating NADH-quinone reductase subunit C
Vibrio cholerae O1 biovar El Tor str. N16961
Length 257 aa, Gene nqrC, UniProt P0C6E0
>NP_231924.1|Vibrio cholerae O1 biovar El Tor str. N16961|Na(+)-translocating NADH-quinone reductase subunit C
MASNNDSIKKTLFVVIALSLVCSIIVSAAAVGLRDKQKENAALDKQSKILQVAGIEAKGSKQIVELFNKSIEPRLVDFNTGDFVEGDAANYDQRKAAKEASESIKLTAEQDKAKIQRRANVGVVYLVKDGDKTSKVILPVHGNGLWSMMYAFVAVETDGNTVSGLTYYEQGETPGLGGEVENPAWRAQWVGKKLFDENHKPAIKIVKGGAPQGSEHGVDGLSGATLTSNGVQNTFDFWLGDMGFGPFLTKVRDGGLN
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -8.59 | 1.3e-11 | ●●●●○ -3.56 | -3.558810864052409 | 24331463 |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)