Bacterial taxon 243277
Locus VC_2291
Protein NP_231922.1
Na(+)-translocating NADH-quinone reductase subunit E
Vibrio cholerae O1 biovar El Tor str. N16961
Length 198 aa, Gene nqrE, UniProt Q9X4Q7
>NP_231922.1|Vibrio cholerae O1 biovar El Tor str. N16961|Na(+)-translocating NADH-quinone reductase subunit E
MEHYISLLVKSIFIENMALSFFLGMCTFLAVSKKVKTSFGLGIAVIVVLTISVPVNNLVYNLVLKPDALVEGVDLSFLNFITFIGVIAALVQILEMILDRFFPPLYNALGIFLPLITVNCAIFGGVSFMVQRDYSFAESVVYGFGSGVGWMLAIVALAGIREKMKYSDVPPGLRGLGITFITAGLMALGFMSFSGVQL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -1.54 | 0.028 | ●○○○○ -0.3 | -0.3049068997441998 | 24331463 |
Retrieved 1 of 1 entries in 0.6 ms
(Link to these results)