Bacterial taxon 243277
Locus VC_1509
Protein NP_231150.1
NAD-dependent deacetylase
Vibrio cholerae O1 biovar El Tor str. N16961
Length 259 aa, Gene cobB, UniProt Q9KRX4
>NP_231150.1|Vibrio cholerae O1 biovar El Tor str. N16961|NAD-dependent deacetylase
MLSLNKSREKEWVMSLPYRHVVILTGAGISAESGIQTFRAQDGLWENHRIEDVATPEGFQRDPDMVLEFYNQRRRKLLSDAIQPNPAHLALGKLEKELQGSVTVITQNIDNLHERGGSQNIIHMHGELLKARCPESNQTVEQKEDIRHGDLCHCCQMPAQMRPHIVWFGEMPLRMGDIYAALEQADLFVSIGTSGVVYPAAGFVHDARMHGAHTIEINLEPSAVESEFAEKRYGKASIEVPRLVEEILAAQARAKESAA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -1.2 | 0.0062 | ●○○○○ -0.15 | -0.14995168404601697 | 24331463 |
Retrieved 1 of 1 entries in 0.5 ms
(Link to these results)