Bacterial taxon 243277
Locus VC_0023
Protein NP_229682.1
NADH dehydrogenase subunit II-like protein
Vibrio cholerae O1 biovar El Tor str. N16961
Length 85 aa, Gene n/a, UniProt Q9KVW5
>NP_229682.1|Vibrio cholerae O1 biovar El Tor str. N16961|NADH dehydrogenase subunit II-like protein
MLTRYMGMTPKSQSYLFSFGLVLTLLGMALTDLWMPMVVGAIVMTALAVESWIRVAHIIPLHDEVRTLQKQLNRLQAELRNLEEE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | 1.08 | 0.0021 | ○○○○○ 0.9 | 0.9041481470493694 | 24331463 |
Retrieved 1 of 1 entries in 1.6 ms
(Link to these results)