Bacterial taxon 243277
Locus VC_A0677
Protein NP_233065.1
nitrate reductase assembly protein NapD
Vibrio cholerae O1 biovar El Tor str. N16961
Length 113 aa, Gene napD, UniProt Q9KLR5
>NP_233065.1|Vibrio cholerae O1 biovar El Tor str. N16961|nitrate reductase assembly protein NapD
MDKLESKMSQPSASLHEVHISSLVVHTLPEHLLTVKQQVSELRDVEIYGEDPQGKLVVVIETDRQGFITETIEHINNLPNVLNAFLVFHQIETVTEEEQLHTGNTFSELEGNV
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -3.07 | 5.7e-7 | ●●○○○ -1.61 | -1.6108232657283132 | 24331463 |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)