Bacterial taxon 243277
Locus VC_0715
Protein NP_230364.1
nitroreductase A
Vibrio cholerae O1 biovar El Tor str. N16961
Length 240 aa, Gene n/a, UniProt Q9KU15
>NP_230364.1|Vibrio cholerae O1 biovar El Tor str. N16961|nitroreductase A
MNPVIDTILSHRSIRAFTQEPISATQLETIIASGIAASSSSLLQVISVIRVTDGSMREQLAEFAGNQAYVASAAEFLVFCIDYQRHYALNPNVKPEFMELTLIGAVDAGIMAQNCLLAAESMGLGGVYIGGLRNSPNEVDALLNLPPYTAVLFGMCLGHPAQEPELKPRLAPKVILHENHYQPLNKEDVAEYDRTMVEYYQKRSGNPKQQGWSEQITAKLSEESRPFMLSYLQRKGLALK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | 0.67 | 0.014 | ○○○○○ 0.71 | 0.7128750233509886 | 24331463 |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)