Bacterial taxon 243277
Locus VC_2039
Protein NP_231673.1
nucleoid-associated protein NdpA
Vibrio cholerae O1 biovar El Tor str. N16961
Length 333 aa, Gene n/a, UniProt Q9KQF9
>NP_231673.1|Vibrio cholerae O1 biovar El Tor str. N16961|nucleoid-associated protein NdpA
MSLFLSNVILHQLRKNDNDELVVNYRAESLRNDTSTENLVAELHRVFNAKAGKGFGCFKSDSEFQLWLQEMRRGTLPFYEFSQQSAQRLKNELAKYPFADEGILVMAEYQSLATDYLFIGLLPLNQSLKVTEGLDISATDYLDINKMDIVARIDLSSYETDKESKRYLSYIKGRVGRKVADFFLDFLQADIGLDTKQQNQVLMQAVEDFCADAKFEKEEVISYKKQVYEYCNDQIKAGDEVRVQELSGELPPSNEGVNFFDFTREQGYQLEESFPADRSTVRKLTKYVGAGGGLNLSFDSLLLGERVFYDPETDTLTIKGTPPNLRDQLTRLR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -2.48 | 4.2e-6 | ●○○○○ -0.74 | -0.7369828348090447 | 24331463 |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)