Bacterial taxon 243277
Locus VC_2450
Protein NP_232079.2
nucleoside triphosphate pyrophosphohydrolase
Vibrio cholerae O1 biovar El Tor str. N16961
Length 271 aa, Gene n/a, UniProt Q9KPC2
>NP_232079.2|Vibrio cholerae O1 biovar El Tor str. N16961|nucleoside triphosphate pyrophosphohydrolase
MSHPIEQLEQIMRRLRDPEQGCPWDKEQTFDTIAPYTIEETFEVVDAITQRDWPNLREELGDLLFQVIFYSQMAKEQGLFEFRDVVETVNEKLTRRHPHVFGDATFENDAQIHANWEAEKAKEKAQAGKSEQSILDSVPRSLPALSRAYKIQKKCAQYGFDWDSLGPVVEKVHEEVEEVMEEALQVDVDTQKVEEELGDLLFATVNLVRHLGHDPEMALSKANAKFVRRFQGVEDKARAKNKPLHAFTLAELDGFWDEVKLEEKQAIKSFS
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -0.78 | 0.0015 | ○○○○○ 0.04 | 0.04364777645369557 | 24331463 |
Retrieved 1 of 1 entries in 1.2 ms
(Link to these results)