Bacterial taxon 243277
Locus VC_1095
Protein NP_230740.1
oligopeptide ABC transporter ATP-binding protein
Vibrio cholerae O1 biovar El Tor str. N16961
Length 336 aa, Gene n/a, UniProt Q9KT10
>NP_230740.1|Vibrio cholerae O1 biovar El Tor str. N16961|oligopeptide ABC transporter ATP-binding protein
MGGLDKMSVEKKLLLDVKDLKVHFNITPKSAWPWTKPVTLKAVDGVNVRLYEGETLGVVGESGCGKSTFARAIIGLVQATHGEVVWLGQDLTRMQEVKRRATRKQIQMIFQDPLASLNPRMTVGDIIAEPLQTFYPELSKQEVKDRVKEMMAKVGLLPNVINRYPHEFSGGQCQRIGIARALILKPKMIICDEPVSALDVSIQAQVVNLLKELQKELGLSLVFIAHDLSVVKHISDRVLVMYLGNAVELGVSKELFANPKHPYTKALMSAVPIPDPNIERNKTIQMLEGDLPSPMNPPSGCVFRTRCPQATAECAKTKPVIKGSDIHSVSCLYAEA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | 1.12 | 0.0014 | ○○○○○ 0.92 | 0.9224003503522612 | 24331463 |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)