Bacterial taxon 243277
Locus VC_2619
Protein NP_232247.1
para-aminobenzoate synthase component II
Vibrio cholerae O1 biovar El Tor str. N16961
Length 193 aa, Gene n/a, UniProt Q9KNW1
>NP_232247.1|Vibrio cholerae O1 biovar El Tor str. N16961|para-aminobenzoate synthase component II
MLLMIDNYDSFTYNLYQYFCELGAQVKVVRNDEIDLDGIRALAPTHLVISPGPCTPNEAGISLAAIEAFAGQLPILGVCLGHQAIAQAFGGQVVRARQVMHGKTSPIRHTGQGLFSGLNNPLTVTRYHSLVVKNDTLPECFELTAWTELSDGSIDEIMGFQHKTLALEAVQFHPESIKTEQGHQLLANFLNRT
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -2.63 | 1.1e-7 | ●○○○○ -0.81 | -0.8077258376764539 | 24331463 |
Retrieved 1 of 1 entries in 1.2 ms
(Link to these results)