Bacterial taxon 243277
Locus VC_2296
Protein NP_231927.1
penicillin binding proteins/beta lactamase transcription regulator BolA
Vibrio cholerae O1 biovar El Tor str. N16961
Length 106 aa, Gene bolA, UniProt Q9KPS0
>NP_231927.1|Vibrio cholerae O1 biovar El Tor str. N16961|penicillin binding proteins/beta lactamase transcription regulator BolA
MIQDVIEKKLSDEFQPEFLKVINESDMHNVPRGSESHFKVTVVSERFAGLRPVARHRLVNQTLADELANHIHALAIHTYTTQEWQQMNQESPESPMCLGGSRKSAQ
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | 1.25 | 0.0016 | ○○○○○ 0.98 | 0.982712899329893 | 24331463 |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)