Bacterial taxon 243277
Locus VC_2184
Protein NP_231815.1
peptidyl-tRNA hydrolase
Vibrio cholerae O1 biovar El Tor str. N16961
Length 196 aa, Gene pth, UniProt Q9KQ21
>NP_231815.1|Vibrio cholerae O1 biovar El Tor str. N16961|peptidyl-tRNA hydrolase
MSQPIKLLVGLANPGPEYAKTRHNAGAWVVEELARIHNVTLKNEPKFFGLTGRLLINSQELRVLIPTTFMNLSGKAIAALANFYQIKPEEIMVAHDELDLPPGVAKFKQGGGHGGHNGLKDTISKLGNNKEFYRLRLGIGHPGHKDKVAGYVLGKAPAKEQECLDAAVDESVRCLEILMKDGLTKAQNRLHTFKAE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -2.52 | 0.00028 | ●○○○○ -0.76 | -0.75787688513115 | 24331463 |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)