Bacterial taxon 243277
Locus VC_2637
Protein NP_232265.1
peroxiredoxin family protein/glutaredoxin
Vibrio cholerae O1 biovar El Tor str. N16961
Length 247 aa, Gene n/a, UniProt Q9KNU3
>NP_232265.1|Vibrio cholerae O1 biovar El Tor str. N16961|peroxiredoxin family protein/glutaredoxin
MRNTMFTSKEGQTIPQVTFPTRQGDAWVNVTSDELFKGKTVIVFSLPGAFTPTCSSTHLPRYNELFPVFKEHGVDSILCVSVNDTFVMNAWKDDQNADNITFIPDGNGEFTDGMGMLVDKNDLGFGKRSWRYSMLVKDGVVEKMFIEPNEPGDPFKVSDADTMLKYIAPQYKVQESVTIFTKPGCPYCAKAKQALIDAGLQYEELILGKDATTVSLRAVSGRTTVPQVFIGGKHIGGSDDLEVYLNQ
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | 0.61 | 0.011 | ○○○○○ 0.69 | 0.6881714234912786 | 24331463 |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)