Bacterial taxon 243277
Locus VC_A0070
Protein NP_232471.2
phosphate ABC transporter substrate-binding protein
Vibrio cholerae O1 biovar El Tor str. N16961
Length 273 aa, Gene n/a, UniProt Q9KN95
>NP_232471.2|Vibrio cholerae O1 biovar El Tor str. N16961|phosphate ABC transporter substrate-binding protein
MKKTVIGAIALMGALAVTPVMAKETISAVGSSSVTPLMEVFSETYAKMNPEVFIEVQGPGSSAGIKAAKNGSADIGMSSRNLKDSEKEATLVEEAIALDGIAVVVHPSNAVKGLTAEQVSEIYKGEITNWKQVGGEDKPIVAITRDTASGTRGAFEDIMELKKKVADKEVSAISQRAQVANGNGALKTMVASNPYAIGYISLGTVDTSVHALAVNGVEASVDNVKNGTYKVSRPFLVLYKQDKPSAEAKKFLDWMLSADAQKIVADKGYITVN
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -2.25 | 7.4e-8 | ●●○○○ -1.08 | -1.0836795689788818 | 24331463 |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)