Bacterial taxon 243277
Locus VC_0726
Protein NP_230375.1
phosphate transporter ATP-binding protein
Vibrio cholerae O1 biovar El Tor str. N16961
Length 273 aa, Gene pstB1, UniProt Q9KU04
>NP_230375.1|Vibrio cholerae O1 biovar El Tor str. N16961|phosphate transporter ATP-binding protein
MYSANPTLGYYVPPLDVNNLTDQQTAISIEHLSLYYQQSRALSDISMRIPKGQVTAFIGPSGCGKSTLLRCINRMNDLVEGTRVEGEVKLHGKNIYHPDVDVPTLRRRVGMVFQRPNPFPKSIYENVVYGLRLQGIKNSRALDDAAEQSLRAAALWDEVKHRLHENAFGLSGGQQQRLVIARAIAIEPEVLLLDEPTSALDPISTLTIEELIHDLKTKYTVVIVTHNMQQAARVSDHTAFIHMGKLIEYADTDSIFTSPLKKQTEDYITGRYG
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -2.53 | 0.0052 | ●○○○○ -0.76 | -0.7621557414713299 | 24331463 |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)