Bacterial taxon 243277
Locus VC_2227
Protein NP_231858.1
phosphoribosylglycinamide formyltransferase
Vibrio cholerae O1 biovar El Tor str. N16961
Length 212 aa, Gene purN, UniProt Q9KPY5
>NP_231858.1|Vibrio cholerae O1 biovar El Tor str. N16961|phosphoribosylglycinamide formyltransferase
MKSIVVLISGNGTNLQAIIDACATSIQDGKVTAVFSNKATAYGLERAKQAGAAACFIDPKAYETRDAFDAALMEQMDKFAPDLVVLAGYMRILSSEFVRHYLGRMINIHPSLLPKYPGLNTYQRAIHAGDEEHGTSVHFVTEQLDGGPVILQAKVPIFEDDTVEELTARVQDQEHRIYPLVVKWFVEERLAMKDGKAYLDGEALGIHGYAAE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -3.6 | 1.0e-11 | ●●○○○ -1.26 | -1.2565858073601441 | 24331463 |
Retrieved 1 of 1 entries in 1.8 ms
(Link to these results)