Bacterial taxon 243277
Locus VC_0916
Protein NP_230563.1
phosphotyrosine protein phosphatase
Vibrio cholerae O1 biovar El Tor str. N16961
Length 166 aa, Gene n/a, UniProt Q9KTI6
>NP_230563.1|Vibrio cholerae O1 biovar El Tor str. N16961|phosphotyrosine protein phosphatase
MKVKGLSVLVVCTGNLCRSPMAEIILRDKIRQKRLNIQVRSAGTLKTGKTMPDDKALQALQDYGYHPMVNPVQQVTQQDFIEHDFIYAMDRTNLADLLDICPAEHKNKLALFLSKANRQEKEVPDPYRRSSEFFQRTALLIESGAVALVDSWQEQGINACNENLSQ
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -2.38 | 1.1e-5 | ●○○○○ -0.69 | -0.6918553493546235 | 24331463 |
Retrieved 1 of 1 entries in 1.4 ms
(Link to these results)