Bacterial taxon 243277
Locus VC_1236
Protein NP_230881.1
PilB-like protein
Vibrio cholerae O1 biovar El Tor str. N16961
Length 148 aa, Gene n/a, UniProt Q9KSM0
>NP_230881.1|Vibrio cholerae O1 biovar El Tor str. N16961|PilB-like protein
MLNWQQVLDFANQGNPKPEREVTRSDEEWRTLLDEQQYYVMRQHGTERAFSNAMCELFEPGLYQCAGCQTLLFDSATKFDSGTGWPSFSQPVKFNAISYHMDQSLARARVEVRCNTCESHLGHVFPDGPPPSGLRYCINSVAVNKLSA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | 2.75 | 0.0036 | ○○○○○ 1.67 | 1.67301035374272 | 24331463 |
Retrieved 1 of 1 entries in 0.5 ms
(Link to these results)