Bacterial taxon 243277
Locus VC_A0659
Protein NP_233048.1
protein F-like protein
Vibrio cholerae O1 biovar El Tor str. N16961
Length 207 aa, Gene n/a, UniProt Q9KLT2
>NP_233048.1|Vibrio cholerae O1 biovar El Tor str. N16961|protein F-like protein
MFEMKFWVLCVTFLLTGCGSLVTDRMFNDNLLDVAPKGDFDVRYPEWGYAPQKNTSVMPNAMTQPRSASYEDLRQYLLSNGIQHEVVPGDYPMIKLNNTVRFETGSAKVSMASKQWLDTVARFLATESGIDIVLEGHTDNTGSEKLNDKLAERRANAVKAALVQSRVAQNAIYTRGFGENVPACTNSTKNGRACNRRVEIRFILASN
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | 1.02 | 0.0037 | ○○○○○ 1.02 | 1.0184930330143798 | 24331463 |
Retrieved 1 of 1 entries in 1.5 ms
(Link to these results)