Bacterial taxon 243277
Locus VC_1057
Protein NP_230702.1
proteinase inhibitor
Vibrio cholerae O1 biovar El Tor str. N16961
Length 83 aa, Gene n/a, UniProt Q9KT48
>NP_230702.1|Vibrio cholerae O1 biovar El Tor str. N16961|proteinase inhibitor
MMDCRLGCGACCIAPSISSPIPGMPNGKPAGVRCVQLNEDNLCQLFGRPERPKVCHDFKACPVVCGKTNQQALANLTELERLT
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -1.6 | 0.00025 | ●○○○○ -0.33 | -0.3308311118333833 | 24331463 |
Retrieved 1 of 1 entries in 0.4 ms
(Link to these results)