Bacterial taxon 243277
Locus VC_1668
Protein NP_231304.1
pseudouridine synthase
Vibrio cholerae O1 biovar El Tor str. N16961
Length 235 aa, Gene n/a, UniProt Q9KRH4
>NP_231304.1|Vibrio cholerae O1 biovar El Tor str. N16961|pseudouridine synthase
MFDILFTHPDFLLINKHPNVSVHKDDGDTMLLQEVATQTGDGQLYLVHRLDKMTSGILLLARNATAASELSQGFAKRKVEKFYLAIGSKKPKKKQGLICGDMERSRRSSWKLVNSQENPAITQFFSAAAATGERLFLCKPHTGKTHQIRVALKSIGSAIVGDPIYNTADESDRGYLHAFALRFTYQGEVYQWLCDPRQFSHLGQKWHEEAVNQGIENWLSPWDLPWPALKVVVKE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -0.81 | 0.00022 | ○○○○○ 0.03 | 0.03368918787418898 | 24331463 |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)