Bacterial taxon 243277
Locus VC_0964
Protein NP_230611.1
PTS system glucose-specific transporter subunit
Vibrio cholerae O1 biovar El Tor str. N16961
Length 169 aa, Gene n/a, UniProt Q9KTD8
>NP_230611.1|Vibrio cholerae O1 biovar El Tor str. N16961|PTS system glucose-specific transporter subunit
MGLFDKLKKLVSDDSANAGAIDIIAPLSGEIVNIEDVPDVVFAEKIVGDGIAIKPAGNKMVAPVNGTIGKIFETNHAFSIESDDGVELFVHFGIDTVELKGEGFKRIAEEGQSVKIGDTIIEFDLALLEEKAKSTLTPVVISNMDEIKELNKLSGSVTVGETPILRVTK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -3.37 | 4.8e-7 | ●●○○○ -1.15 | -1.1489291523068692 | 24331463 |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)