Bacterial taxon 243277
Locus VC_A0053
Protein NP_232454.2
purine nucleoside phosphorylase
Vibrio cholerae O1 biovar El Tor str. N16961
Length 236 aa, Gene deoD2, UniProt Q9KNB2
>NP_232454.2|Vibrio cholerae O1 biovar El Tor str. N16961|purine nucleoside phosphorylase
MATPHINAQPGDFAETVLMPGDPLRAKYIAETFLEDVKQVCDVRSMFGFTGTYKGKKVSVMGHGMGIPSCSIYVHELIAEYGVKNIIRIGSCGAVRDDVKLMDVVIGMGASTDSKVNRIRFSGHDFAAIADYDLLETAVNQARAQQVPVKVGNVFSADLFYTPEPEIFEKMKKLGILGVDMEAAGIYGVAADLGARALTILTVSDHILRGEKLSSEDRQKSFNDMMKVALETAINI
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -0.99 | 0.048 | ●○○○○ -0.27 | -0.2724485314200778 | 24331463 |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)