Bacterial taxon 243277
Locus VC_A1094
Protein NP_233474.1
purine-binding chemotaxis protein CheW
Vibrio cholerae O1 biovar El Tor str. N16961
Length 175 aa, Gene n/a, UniProt Q9KKL0
>NP_233474.1|Vibrio cholerae O1 biovar El Tor str. N16961|purine-binding chemotaxis protein CheW
MNSANLTTSSSAALEPILSMDMGLTGGADFLSFMLGTELYGVTLSHVEEIRVWEKPTPIPRAPHFVKGVINLRGMIVPIIDLRQRFGLTQYEYLPTTVVLILSAREQEQKRLMGLVVDSVSDVIGQGDMPLHPAIGESMVVPFLSGILNVGDEVMSLLDSDALLDMDRILNEGQA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | 1.5 | 3.7e-5 | ○○○○○ 1.32 | 1.323608322886109 | 24331463 |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)