Bacterial taxon 243277
Locus VC_0460
Protein NP_230114.1
pyrroline-5-carboxylate reductase
Vibrio cholerae O1 biovar El Tor str. N16961
Length 272 aa, Gene proC, UniProt Q9KUQ5
>NP_230114.1|Vibrio cholerae O1 biovar El Tor str. N16961|pyrroline-5-carboxylate reductase
MEQRSIAFIGAGNMARAIIAGLIASGYAADKIIATAPSLTRREPLEAQYGIRTTSDNLAAAQQADVVVLAVKPQLMAEVCKPLQAVDFSGKLVISIAAGVSVKRLNEMLATQLNLVRVMPNTPSLVNLGMSGLYAPDSVSEADKAFTTQLMQSVGEVCWVDNESGINSVIAAAGSAPAYFFLFMQAMQQEAMAQGFDEATARLLVQQSALGAAAMVKANPELSLATLREQVTSKGGTTAQAIQTFNDHQLSDIVAKAMQAAVTRAQEMEQLF
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -1.34 | 0.022 | ●○○○○ -0.21 | -0.214713914275871 | 24331463 |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)