Bacterial taxon 243277
Locus VC_0544
Protein NP_230195.1
recombination regulator RecX
Vibrio cholerae O1 biovar El Tor str. N16961
Length 152 aa, Gene recX, UniProt Q56647
>NP_230195.1|Vibrio cholerae O1 biovar El Tor str. N16961|recombination regulator RecX
MSFDLATCRQSALQLLSRRDHSEYELYQKLALKGHPAEVIDEVVKYVLELGYLSDARYAASQARQIVHKGYGEQRLRQQLKEKRVAEEVIEQALAEQTIDWFELAKEVAHKKFKSGISHERSQYAKQVRYLQYRGFNFEQIRYALQASESDE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -1.3 | 0.0005 | ●○○○○ -0.2 | -0.19558322671602218 | 24331463 |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)