Bacterial taxon 243277
Locus VC_A0349
Protein NP_232745.2
RelB protein
Vibrio cholerae O1 biovar El Tor str. N16961
Length 94 aa, Gene n/a, UniProt Q9K3D4
>NP_232745.2|Vibrio cholerae O1 biovar El Tor str. N16961|RelB protein
MDTRIQFRVDEETKRLAQQMAESQGRTLSDACRELTEQLAEQQRKALSHDAWLTEQVNQAFEKFDSGKAVFIEHDIAKARMAERKAKIRNRGHA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | 0.45 | 5.1e-7 | ○○○○○ 0.65 | 0.6539196666097369 | 24331463 |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)