Bacterial taxon 243277
Locus VC_A0504
Protein NP_232895.2
RelB protein
Vibrio cholerae O1 biovar El Tor str. N16961
Length 94 aa, Gene n/a, UniProt Q9K3D4
>NP_232895.2|Vibrio cholerae O1 biovar El Tor str. N16961|RelB protein
MDTRIQFRVDEETKRLAQQMAESQGRTLSDACRELTEQLAEQQRKALSHDAWLTEQVNQAFEKFDSGKAVFIEHDIAKARMAERKAKIRNRGHA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | 0.55 | 0.021 | ○○○○○ 0.72 | 0.7183754585945177 | 24331463 |
Retrieved 1 of 1 entries in 8.6 ms
(Link to these results)