Bacterial taxon 243277
Locus VC_1348
Protein NP_230992.2
response regulator
Vibrio cholerae O1 biovar El Tor str. N16961
Length 379 aa, Gene n/a, UniProt Q9KSB1
>NP_230992.2|Vibrio cholerae O1 biovar El Tor str. N16961|response regulator
MSMEDLSQCTILIVDDSPDNIAFMSQGLAQYYRIKAARSGKVALEILAQYPIDLVLLDIVMPEMSGYEVINQIKHNPHTEHIPVIFLTGKSNPEDEQLGFELGAVDYVFKPVSIPLLKSRVHTHLQNKRSKDILLNQNDYLETEVLRRSGELDRMQDAVVFALASLAETRDPETGNHLLRTQHYVKVLAQRLATTDKYRDVLSPTVIDTYFKAAPLHDIGKVGIPDNILLKPGKLTPDEFTTMRNHALLGKLALEKAEKLSGACTALINVAKEIAMGHHEKWDGSGYPLGLKGDDIPLSARLMALADVYDALICRRVYKEPMSHEEAKAIILQGRGSHFDPMVIDAFLIEEQNFIDIAQKFADEESAMVPIQLGQQASG
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -1.88 | 7.6e-6 | ●○○○○ -0.46 | -0.4624096118402329 | 24331463 |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)