Bacterial taxon 243277
Locus VC_2672
Protein NP_232300.1
ribonuclease activity regulator protein RraA
Vibrio cholerae O1 biovar El Tor str. N16961
Length 171 aa, Gene rraA, UniProt Q9KNQ9
>NP_232300.1|Vibrio cholerae O1 biovar El Tor str. N16961|ribonuclease activity regulator protein RraA
MEYNTSALCDIYLDQVDVVEPMFSNFGGCASFAGQITTIKCYEDNGLIRETLEQDGLGRILLIDGGGSLRRALIDAELAALAEENEWEGIVVYGSVREVDELEEMSIGIQAIASIPVGATSQGIGEVDIPVNFGGVTFLPEDYLYADNTGIIISQEPLSADLGEEEEDELL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -0.77 | 0.00016 | ○○○○○ 0.05 | 0.051606670261761516 | 24331463 |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)