Bacterial taxon 243277
Locus VC_2028
Protein NP_231662.1
ribosomal large subunit pseudouridine synthase C
Vibrio cholerae O1 biovar El Tor str. N16961
Length 315 aa, Gene rluC, UniProt Q9KQH0
>NP_231662.1|Vibrio cholerae O1 biovar El Tor str. N16961|ribosomal large subunit pseudouridine synthase C
MNEIRTQVQFIDIDEDMAGQRIDNFLRNQLKNIPKSVVYRILRKGEVRVNKKRVKAEYKLEAGDVVRVPPVTVEVKENEPAPPSTKLSKVAELEHCIVYEDDHLLILNKPSGTAVHGGSGLHFGAIEALRALRPQARFLELVHRIDRDTSGILLVAKKRSALRHLQAQFREKTVQKYYYALVMGHWDAECKVVNAPLLKNEVNSIVRVNPNGKPSETRFRILEKFAEATLVQASPVTGRTHQIRVHTQYMGHPIAWDDRYGDRRFDAYTAQFGIERLFLHAANIQFVHPASEKKLEIHAPLEAHLEQALTKMRQA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -2.01 | 5.8e-7 | ●○○○○ -0.52 | -0.5232689611931837 | 24331463 |
Retrieved 1 of 1 entries in 1.3 ms
(Link to these results)