Bacterial taxon 243277
Locus VC_0657
Protein NP_230306.1
ribosomal-protein-alanine acetyltransferase
Vibrio cholerae O1 biovar El Tor str. N16961
Length 161 aa, Gene n/a, UniProt Q9KU66
>NP_230306.1|Vibrio cholerae O1 biovar El Tor str. N16961|ribosomal-protein-alanine acetyltransferase
MAANLRSSRNRIMTTVFTAMQPTHLDAVWRIECAAHSHPWAESLVRDLTSRGACHQVMLVDQQVVGYFYAQNIVGEVTLLNIAIDPAQQGKGYGQQLLQHFIALCEQQKAESAWLEVRESNQRAFALYQRAGFNEIDRRVNYYPVAKGKSEDAIIMSYLFL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -1.63 | 0.0089 | ●○○○○ -0.35 | -0.3458667934038303 | 24331463 |
Retrieved 1 of 1 entries in 1.3 ms
(Link to these results)