Bacterial taxon 243277
Locus VC_2625
Protein NP_232253.1
ribulose-phosphate 3-epimerase
Vibrio cholerae O1 biovar El Tor str. N16961
Length 236 aa, Gene n/a, UniProt Q9KNV5
>NP_232253.1|Vibrio cholerae O1 biovar El Tor str. N16961|ribulose-phosphate 3-epimerase
MFSLHSIPNEVGMKDFLIAPSILSADFARLGEDVAKVLAAGADVVHFDVMDNHYVPNLTFGAPICKALRDYGITAPIDVHLMVKPVDRIIPDFAKAGASMITFHVEASEHVDRTLQLIKECGCQAGVVLNPATPLHHLDYIMDKVDLILLMSVNPGFGGQSFIPHTLDKLRAVRERIKQSGRPIRLEIDGGVKVENIREIAEAGADMFVAGSAIFGQPDYQAVIEQMRAELAKAKI
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -2.01 | 0.0048 | ●○○○○ -0.52 | -0.5219597797717044 | 24331463 |
Retrieved 1 of 1 entries in 1.2 ms
(Link to these results)