Bacterial taxon 243277
Locus VC_0159
Protein NP_229816.1
RNA-binding protein
Vibrio cholerae O1 biovar El Tor str. N16961
Length 152 aa, Gene n/a, UniProt Q9KVI6
>NP_229816.1|Vibrio cholerae O1 biovar El Tor str. N16961|RNA-binding protein
MKSDKSMLWIALLAVIGAGILSQLTLHSSFAFLIGVVATALICKLSTHPTLSSSEDEEASSTTKTLYVGNLPYKANESHVKELFAEFGEVFAVRLMKDKRTGKRRGFGFVVIAASQAQTAIDALNEKEYMQRTLKVRIANDPKSDEEMAEQD
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | 1.56 | 3.7e-5 | ○○○○○ 1.13 | 1.126116880207176 | 24331463 |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)