Bacterial taxon 243277
Locus VC_A0627
Protein NP_233016.1
rRNA methylase
Vibrio cholerae O1 biovar El Tor str. N16961
Length 170 aa, Gene n/a, UniProt Q9KLW4
>NP_233016.1|Vibrio cholerae O1 biovar El Tor str. N16961|rRNA methylase
MTTSSTVIIGLHNPKSPTNVGAVMRAAGCYNATQVRYNGTRYARAVKFQTDTQNSHERIGLVEMDDLTAGLDSEVKIVCVELAVGATALPHFTHPEQAIYLFGPEDGSLPQEVVDQAHYVVYVPTHGCMNLAATVNVVLYDRLAKSLGEIDDQAQVIANRDNKNRLKVKS
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | 0.36 | 0.026 | ○○○○○ 0.6 | 0.5974357364650138 | 24331463 |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)