Bacterial taxon 243277
Locus VC_0087
Protein NP_229746.1
sec-independent translocase
Vibrio cholerae O1 biovar El Tor str. N16961
Length 133 aa, Gene tatB, UniProt P57063
>NP_229746.1|Vibrio cholerae O1 biovar El Tor str. N16961|sec-independent translocase
MFDIGFWELVLIAIVALVVLGPERLPHAIRSVAKFVSAAKSMANSVKDELAHELKVQELQENLRKAEQMGMQNLSPELQKSVESLKQAAQEVQRPYAATPSSEASSTSSNPSSATEPDVRLDSASQPAEKKAE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -1.2 | 0.0051 | ●○○○○ -0.15 | -0.14685701863063322 | 24331463 |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)