Bacterial taxon 243277
Locus VC_1959
Protein NP_231593.1
septum formation inhibitor
Vibrio cholerae O1 biovar El Tor str. N16961
Length 220 aa, Gene minC, UniProt Q9KQN9
>NP_231593.1|Vibrio cholerae O1 biovar El Tor str. N16961|septum formation inhibitor
MSKNPDLKGSSFTLSVLHLSDNQIAHTVQFLQEKIAQAPAFFANAPVVINVAKVEGDIDYPALKQGISQAGLIPVGVTGCKDKRSQNLAVEAGFAVMTATNSPAQAPAQMAPTKVIRTPVRSGQQIYAKDGDLVILSHVSAGAEVIADGSIHIYGTLRGRAIAGASGQREARIICHDLQAELISIAGRYWLSDQIESQFWQQRVMLSMTDESLYLETLTI
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -0.62 | 0.019 | ○○○○○ 0.12 | 0.1176429276116478 | 24331463 |
Retrieved 1 of 1 entries in 0.6 ms
(Link to these results)