Bacterial taxon 243277
Locus VC_A0947
Protein NP_233331.1
spermidine n1-acetyltransferase
Vibrio cholerae O1 biovar El Tor str. N16961
Length 173 aa, Gene speG, UniProt Q9KL03
>NP_233331.1|Vibrio cholerae O1 biovar El Tor str. N16961|spermidine n1-acetyltransferase
MNSQLTLRALERGDLRFIHNLNNNRNIMSYWFEEPYESFDELEELYNKHIHDNAERRFVVEDAQKNLIGLVELIEINYIHRSAEFQIIIAPEHQGKGFARTLINRALDYSFTILNLHKIYLHVAVENPKAVHLYEECGFVEEGHLVEEFFINGRYQDVKRMYILQSKYLNRSE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | 1.01 | 3.4e-5 | ○○○○○ 1.01 | 1.0129314512972474 | 24331463 |
Retrieved 1 of 1 entries in 0.4 ms
(Link to these results)