Bacterial taxon 243277
Locus VC_0848
Protein NP_230495.1
SsrA-binding protein
Vibrio cholerae O1 biovar El Tor str. N16961
Length 161 aa, Gene smpB, UniProt P52116
>NP_230495.1|Vibrio cholerae O1 biovar El Tor str. N16961|SsrA-binding protein
MTKKKTNTKAGSNTIALNKKARHEYFIEDEFEAGMELQGWEVKSLRQGKANIAESYVYIKDGEAFISGMTIIPLQQASTHVVANPTRIRKLLLSRRELDNLFGRINREGMTLTALSLYWSRSWVKIKIGVAKGKKLHDKREDLKEKEWQRQKDRVMKSALR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -1.81 | 0.00015 | ●○○○○ -0.43 | -0.427940493939698 | 24331463 |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)