Bacterial taxon 243277
Locus VC_0576
Protein NP_230227.1
stringent starvation protein A
Vibrio cholerae O1 biovar El Tor str. N16961
Length 211 aa, Gene n/a, UniProt Q9KUE5
>NP_230227.1|Vibrio cholerae O1 biovar El Tor str. N16961|stringent starvation protein A
MAVAANKRSVMTLFSSASDMYSHQVRIVLAEKGVSFEVELVDENNLPAELIELNPYKTVPTLVDRELALYDSKIIMEYLDERFPHPPLMPVYPVARGNSRLMIYRIERNWYSLAEKVVNGSPEVAENARNKLRNDLLTLGPVFAEFEYFMSEEFSLIDCYLAPLLWRLPVLGIDLIGPGSKELKVYMNRVFERDSFLASLTEAEREMRLAR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -7.54 | 9.9e-15 | ●●●●○ -3.07 | -3.0705029513163122 | 24331463 |
Retrieved 1 of 1 entries in 0.5 ms
(Link to these results)