Bacterial taxon 243277
Locus VC_2090
Protein NP_231722.1
succinate dehydrogenase hydrophobic membrane anchor protein
Vibrio cholerae O1 biovar El Tor str. N16961
Length 114 aa, Gene n/a, UniProt Q9KQB0
>NP_231722.1|Vibrio cholerae O1 biovar El Tor str. N16961|succinate dehydrogenase hydrophobic membrane anchor protein
MVKHVSSFGRNGVHDYLLIRASAIILVLYTIYIVSFCAFTDISYVAWTQFFGSTFTKVFTMLALVSVLIHGWIGLWQVLTDYIKCSKLRAGLQLVVIAVLLGYFFSGLFVLWGA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -3.88 | 1.6e-8 | ●●○○○ -1.39 | -1.3863062109414839 | 24331463 |
Retrieved 1 of 1 entries in 0.5 ms
(Link to these results)