Bacterial taxon 243277
Locus VC_0539
Protein NP_230190.1
sulfate ABC transporter permease
Vibrio cholerae O1 biovar El Tor str. N16961
Length 283 aa, Gene n/a, UniProt Q9KUI2
>NP_230190.1|Vibrio cholerae O1 biovar El Tor str. N16961|sulfate ABC transporter permease
MGQTLAHSRPRQQRVLPGFALSLGVSLLFVSLILLLPATGLIMQTSNMTFSEYWQVIADPRVVASYKVTVGSALIASLFNGLFGLLLAWVLVRYTFPGKRILDALVDLPFALPTAVAGITLATLYSANGWIGSVLAELGIKVAYTPLGIIVAMAFTSIPFVVRTVQPVLEEISREEEEAGMTLGASDAAVFWKVILPSLKPALLVGTALSFTRSLGEFGAVIFIAGNMPYISEITSLMIFVRLQEFDFPAASAIASVVLLTSLLLLLMINLWQGAYLRSIHGR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -1.91 | 0.0069 | ●○○○○ -0.48 | -0.4775460587576989 | 24331463 |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)