Bacterial taxon 243277
Locus VC_A0917
Protein NP_233302.1
TetR family transcriptional regulator
Vibrio cholerae O1 biovar El Tor str. N16961
Length 161 aa, Gene n/a, UniProt Q9KL32
>NP_233302.1|Vibrio cholerae O1 biovar El Tor str. N16961|TetR family transcriptional regulator
MTLEKSLTMPKRSKEDTEVTIQTIMDAVVDQLLRLGYDKMSYTTLSQQTGVSRTGISHHFPKKTDFASALDGRIFKMFMEYLDFEHDMEAFRDSWLKAMEKSEFVAILRLLFHHIVTAERAHDFAHKGVNRLYKLTEEKFGQESQKEVEWLLGHSLVSMVN
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -0.49 | 0.038 | ○○○○○ 0.05 | 0.047891449292661134 | 24331463 |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)