Bacterial taxon 243277
Locus VC_0287
Protein NP_229942.1
thermoresistant gluconokinase
Vibrio cholerae O1 biovar El Tor str. N16961
Length 171 aa, Gene n/a, UniProt Q9KV70
>NP_229942.1|Vibrio cholerae O1 biovar El Tor str. N16961|thermoresistant gluconokinase
MAGSSIIVMGVCACGKSTIGELLAKQTGRKFIDGDDLHPRANIQKMASGQPLNDEDRKPWLERIRDAAYSLESKNEHGVIVCSALKKQYRDQIREGNQNVTFLFLDGSKELIMERMRARQGHFMKENMVNSQFETLERPDGEPQTLIIPIDCSVQEVVSCAIQALQEQEGL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -1.75 | 0.00015 | ●○○○○ -0.4 | -0.4038710281480136 | 24331463 |
Retrieved 1 of 1 entries in 1.2 ms
(Link to these results)