Bacterial taxon 243277
Locus VC_2539
Protein NP_232167.1
thiamine transporter substrate binding subunit
Vibrio cholerae O1 biovar El Tor str. N16961
Length 330 aa, Gene n/a, UniProt Q9KP40
>NP_232167.1|Vibrio cholerae O1 biovar El Tor str. N16961|thiamine transporter substrate binding subunit
MKFQLTAVALATLCVASAASAAPTLTVYTYDSFAAEWGPAPAIEKAFEAQCGCDLQFVALDDGVSILNRLRLEGSNSKADVVLGLDNNLIEEAKQTGLLATHSVDTSKVTLPNGWSDNTFVPYDYGYFAFVYNKEKLANPPTSLKELVEKRDDLKVIYQDPRTSTPGQGLLLWMKSVYGDQAPQAWKQLASKTVTVTKGWSEAYSMFLGGEADLVLSYTTSPAYHLIAENDARFATANFSEGHYLQVEVAAKVKSTKNGELADKFLQFILSNEFQSVIPTGNWMYPVTAVELPKGFDTLAVPTQSLSFSAQEVAQMRKPWIREWQQALSF
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -1.45 | 0.0067 | ●○○○○ -0.26 | -0.26334458388610266 | 24331463 |
Retrieved 1 of 1 entries in 0.6 ms
(Link to these results)